Protein Info for ABIE41_RS04180 in Bosea sp. OAE506

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 PF11638: DnaA_N" amino acids 50 to 108 (59 residues), 68.5 bits, see alignment 6.8e-23 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 52 to 517 (466 residues), 458.1 bits, see alignment E=1.8e-141 PF00308: Bac_DnaA" amino acids 179 to 399 (221 residues), 229.2 bits, see alignment E=1.1e-71 PF01695: IstB_IS21" amino acids 222 to 288 (67 residues), 26.2 bits, see alignment E=1.1e-09 PF08299: Bac_DnaA_C" amino acids 428 to 496 (69 residues), 103.4 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 58% identical to DNAA_BRASB: Chromosomal replication initiator protein DnaA (dnaA) from Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 66% identity to mpo:Mpop_0002)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>ABIE41_RS04180 chromosomal replication initiator protein DnaA (Bosea sp. OAE506)
MTEEMGQTMFERRRMDETVEVVSALSVVVPAEQARSVERETVTVLANASEAWDRVRRRLR
AELGEDVFSSWFARVELGNIVDGVAYLTVPTRFLKSWLEAHYAERLRVNCMAELQGLNGI
MLSVRPVSRDLTQPPAEIVPLRGRQPAAAPAAEPKPAPAGSAPIEAAERDLVDACGTVLD
RRMNFQAFIVGKSNQLAFAAAERIAAAPAGSSPYNPLYIHAGVGLGKTHLLQAIAQEARS
QGKRVAYFTADRFMYGFVAALKSQTALAFKEKLRGIDLLVVDDVQFIQGKSIQQEFGHTI
NALIDAGKQIVVAGDRMANDLEALDERIRSRLGGGLVVEVGDLDEALRAKILGNRLDALQ
AAHPNFQVHPDVVAYVARVVATNGRDLDGAANRLLAHATLSGQPVSLETAEAAIRDLVRT
REPRRVKIEDIQKLVATRYNVSRADILSERRTAAVVKPRQIAMYLAKALTPRSLPEIGRR
FGGRDHTTVLHAVRKIEKAIAEDRTLHDEVDLLKRMLQE