Protein Info for ABIE41_RS04135 in Bosea sp. OAE506

Annotation: glutaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03814: glutaminase A
  • amino acids 9 to 307 (299 residues), 393 bits, E=3.9e-122
• PF04960: Glutaminase
  • amino acids 22 to 307 (286 residues), 364.4 bits, E=1.9e-113

Best Hits

Swiss-Prot: 69% identical to GLSA_METRJ: Glutaminase (glsA) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: K01425, glutaminase [EC: 3.5.1.2] (inferred from 74% identity to sjp:SJA_C1-21570)

Predicted SEED Role

"Glutaminase (EC 3.5.1.2)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.2)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• D-Glutamine and D-glutamate metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.2

Protein Sequence (310 amino acids)

>ABIE41_RS04135 glutaminase (Bosea sp. OAE506)
MKDLARLVREIADEMTAIPDRGAVATYIAPLAAVDPARFGLCVVTAEGEVHWAGDALEPF
SIQSISKVFALTQALGKVGEALWQRVGREPSGTPFNSIVQLEREQGIPRNPFINAGALVV
ADVNLGGHAPRVAIGELLRFVRHLADDDGIAIDEPVARAEQATGFRNIALANYMKAFGNI
RHAPELTLGVYFHQCAIAMNCLQLAMAGRYLMHGGVLRPGGARIVSSRRARRINALMLTC
GHYDASGDFAFRVGLPGKSGVGGGILAIAPGRASIAVWSPGLNANGNSQIGTLALERLAE
ATGWSVFGAA