Protein Info for ABIE41_RS04095 in Bosea sp. OAE506

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF04542: Sigma70_r2" amino acids 14 to 76 (63 residues), 58.6 bits, see alignment E=9e-20 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 16 to 157 (142 residues), 88.8 bits, see alignment E=1.6e-29 PF07638: Sigma70_ECF" amino acids 72 to 156 (85 residues), 29.2 bits, see alignment E=1.6e-10 PF08281: Sigma70_r4_2" amino acids 103 to 154 (52 residues), 60.3 bits, see alignment E=2.3e-20 PF04545: Sigma70_r4" amino acids 107 to 154 (48 residues), 41.5 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 56% identical to ECFG_RHOPT: ECF RNA polymerase sigma factor EcfG (ecfG) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 61% identity to mci:Mesci_1433)

Predicted SEED Role

"RNA polymerase sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>ABIE41_RS04095 sigma-70 family RNA polymerase sigma factor (Bosea sp. OAE506)
MSSTEFKDGLIKEIPNLRAFAASLSGSIQLADDLVQDTLLKAWGNSEKFEPGTSLRAWLF
TILRNTYYSLYRKRGREVQDSEGTYAERMATHGNQESHLDLADFRKALAKLPEEQREVLI
MVGATGLSYEETAEICGVAIGTIKSRVNRARTKLAELLSIGSLDDLGPDRQSAAAIQRVG
SEIVGP