Protein Info for ABIE41_RS03965 in Bosea sp. OAE506

Annotation: imidazoleglycerol-phosphate dehydratase HisB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00475: IGPD
  • amino acids 32 to 174 (143 residues), 228.3 bits, E=1.9e-72

Best Hits

Swiss-Prot: 75% identical to HIS7_METRJ: Imidazoleglycerol-phosphate dehydratase (hisB) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: K01693, imidazoleglycerol-phosphate dehydratase [EC: 4.2.1.19] (inferred from 74% identity to mdi:METDI3278)

Predicted SEED Role

"Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)" in subsystem Histidine Biosynthesis (EC 4.2.1.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (41/46 steps found)
• L-histidine biosynthesis (9/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.19

Protein Sequence (195 amino acids)

>ABIE41_RS03965 imidazoleglycerol-phosphate dehydratase HisB (Bosea sp. OAE506)
MRSGEVKRRTNETDIAVSLVLDGTGKAEIASGVGFFDHMLDLFARHSLIDLKVAVKGDTH
IDDHHSVEDTGIALGEALKQALGDKKGIRRYADIHLPMDETLTRVAVDVSGRPFLVFRTR
FEAQKIGTFDTELVREFFQAFAMNAGITLHVETLYGDNAHHIAESCFKGLARALRHALEV
DLREGGRVPSTKGAL