Protein Info for ABIE41_RS03820 in Bosea sp. OAE506

Annotation: type I pantothenate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00554: pantothenate kinase
  • amino acids 17 to 323 (307 residues), 428.7 bits, E=6.9e-133
• PF00485: PRK
  • amino acids 97 to 254 (158 residues), 43.9 bits, E=1.3e-15

Best Hits

Swiss-Prot: 66% identical to COAA_AGRRK: Pantothenate kinase (coaA) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: K00867, type I pantothenate kinase [EC: 2.7.1.33] (inferred from 81% identity to met:M446_6788)

Predicted SEED Role

"Pantothenate kinase (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

• phosphopantothenate biosynthesis I (3/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (7/10 steps found)
• phosphopantothenate biosynthesis II (1/3 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (2/5 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (4/9 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Protein Sequence (324 amino acids)

>ABIE41_RS03820 type I pantothenate kinase (Bosea sp. OAE506)
MDQRAMPAPALPDLDSPYRSFTRDEWAHLRADTPLTLSVDDLTKLQSINDPISLDEIVAI
YLPLSRLLSLYVAATQGLFKATQRFLLAEAEVKVPYIIGVAGSVAVGKSTTARVLKALLS
RWPNTPKVELVTTDGFLLPNAELERRGLMQRKGFPESYDGSAILRFLSDVKAGKPQVKAP
VYSHLVYDVVPGETVTVERPDILILEGLNVLQPSRMPKDGTVIPFVSDYFDFSVYLDADE
NDLHRWYVNRFMTLRQTAFRDPRSFFRKYAEIAEEEALTIAENLWTGINLPNLQENILPT
RQRASLILTKGASHRIQQVALRRL