Protein Info for ABIE41_RS03365 in Bosea sp. OAE506

Annotation: cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08211: dCMP_cyt_deam_2
  • amino acids 11 to 82 (72 residues), 35.2 bits, E=1.4e-12
• PF00383: dCMP_cyt_deam_1
  • amino acids 11 to 109 (99 residues), 58.3 bits, E=6.1e-20
• TIGR01354: cytidine deaminase
  • amino acids 12 to 136 (125 residues), 138.7 bits, E=6.4e-45

Best Hits

Swiss-Prot: 43% identical to CDD_HUMAN: Cytidine deaminase (CDA) from Homo sapiens

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 71% identity to met:M446_1621)

MetaCyc: 43% identical to cytidine deaminase monomer (Homo sapiens)
Cytidine deaminase. [EC: 3.5.4.5]; 3.5.4.5 [EC: 3.5.4.5]

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

• pyrimidine deoxyribonucleosides degradation (3/3 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (5/6 steps found)
• pyrimidine ribonucleosides degradation (2/2 steps found)
• superpathway of pyrimidine ribonucleosides degradation (4/5 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• pyrimidine ribonucleosides salvage II (1/2 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (6/9 steps found)
• pyrimidine ribonucleosides salvage I (1/3 steps found)
• pyrimidine deoxyribonucleosides salvage (2/5 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Protein Sequence (139 amino acids)

>ABIE41_RS03365 cytidine deaminase (Bosea sp. OAE506)
MGTSPEAIDFEALFAAAARVQTFAYAPYSRFRVGAAILGEDGVVYPGCNVENAAYPSGSC
AEQGAISAMIAGGSERIRAILVVGDGDELVTPCGACRQRIREFAAPETPVAIAGPGGIRQ
MFSLAELLPASFGPDNLRR