Protein Info for ABIE41_RS03210 in Bosea sp. OAE506

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 144 to 170 (27 residues), see Phobius details amino acids 177 to 202 (26 residues), see Phobius details amino acids 222 to 265 (44 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 324 to 352 (29 residues), see Phobius details amino acids 359 to 361 (3 residues), see Phobius details amino acids 363 to 398 (36 residues), see Phobius details amino acids 408 to 432 (25 residues), see Phobius details PF06808: DctM" amino acids 16 to 424 (409 residues), 315 bits, see alignment E=3.7e-98 TIGR00786: TRAP transporter, DctM subunit" amino acids 27 to 430 (404 residues), 360.7 bits, see alignment E=4.3e-112

Best Hits

KEGG orthology group: None (inferred from 54% identity to rde:RD1_3607)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>ABIE41_RS03210 TRAP transporter large permease (Bosea sp. OAE506)
MTGSVLSSGQAASILFGCFFLGLFLRIPVAFALGLACLPILIIEPRLDSMTLMSETFNAF
NSFILLAVPFFLLTANLMNVGGVTDRLMSLSRALVGHFPGGLAQINVVLSFFFAGISGSS
TADAASQSKIFIEAQRKEGYDDSFSVAITAVSAVLAVIIPPSILMIVWGGILTTSIGALF
LAGVIPGLLIGVAQMATVHAYAVRRGYPTYPRSSVRQVFSAVERAALALLTPGIIIGGKV
FGWFTATESAAIAVVYAAFLSLLVYREMNLKGLYAALLDTGKLAGVTLFCVGTASAFGWL
MAYYKMPQAILTGVSAWGMGFYETGFFIAGIFLLVGCFLDAIPAIIIVGPILAPLAKTVM
MDPVHFAMIGIVSLAFGLVTPPYGLCLMIACSVAGISMRSAIKDTMIMLMPMLIVLALII
MWPTVSLFLPSLISPEFLN