Protein Info for ABIE41_RS03155 in Bosea sp. OAE506

Annotation: YifB family Mg chelatase-like AAA ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 TIGR00368: Mg chelatase-like protein" amino acids 9 to 502 (494 residues), 508.7 bits, see alignment E=7.8e-157 PF13541: ChlI" amino acids 20 to 139 (120 residues), 132.3 bits, see alignment E=2.5e-42 PF01078: Mg_chelatase" amino acids 189 to 396 (208 residues), 309.5 bits, see alignment E=2.7e-96 PF07728: AAA_5" amino acids 212 to 348 (137 residues), 27.8 bits, see alignment E=7e-10 PF00493: MCM" amino acids 284 to 347 (64 residues), 26.4 bits, see alignment E=1.1e-09 PF13335: Mg_chelatase_C" amino acids 404 to 502 (99 residues), 97.3 bits, see alignment E=2e-31

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 79% identity to mrd:Mrad2831_3140)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>ABIE41_RS03155 YifB family Mg chelatase-like AAA ATPase (Bosea sp. OAE506)
MVTRVATVAFEGIEARAVDVQVQVTPGGVNFILVGLPDKAVGESKERVRSALIASGLALP
AKRITVNLAPADLPKEGSHYDLPIALGVMAAIGAIPADALAGYTVLGELALDGSISAVAG
VLPAAIAAYGRGQGLICPHACGPEAAWAAADIDILAPRSLIQLANHFKGTQVMARPEPAV
ARQAGPLPDLADIKGQESAKRVLEIAAAGGHNLLMNGPPGAGKSMLASRLPSILPPLGPR
ELLEVSMVLSVAGHLAEGALTDRRPFRAPHHSASMAALVGGGLQAKPGEVSLAHHGVLFL
DELPEFQAQALDALRQPMETGDVLISRANHRAIYPARFQLVAAMNPCRCGKATEPGFACR
RQQNERCMAQYQSRISGPMLDRIDIAINVPAVTAADLILPAASEGSAEVAARVAAARRLQ
TARFEALGLSGVTTNAACPAPVLDEIARPDNAGLALLRDAADAMRLTARAYHRVLKVART
LADLDGEARVGRIHLAEALSYRTRSDQVAQAA