Protein Info for ABIE41_RS03060 in Bosea sp. OAE506

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 transmembrane" amino acids 41 to 58 (18 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 142 to 172 (31 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 238 to 255 (18 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (637 amino acids)

>ABIE41_RS03060 hypothetical protein (Bosea sp. OAE506)
MLLVWGPFQPYPPIGWVDPQLYINWFLTPAENYLYRGTDYHGARLAVVVPGAILYRLLEP
LSAQVAFVGLFYLTAVTAIYRIAGETLSTPSLRLAITAILAGNPLFVAAFARGYVDGPAI
ALGLLATALIFTGFRGDRRSAFVAAGASAFAAIAAHPFGGGIAGATAAVLILSAPARLPR
LVAFAAGAIAMAAALSIGGYALGLPLTFMLSVASDIAMSFQRDGQAFLTPLSSWAPSTPR
LVVPPLVAVLIAIGWSTRSRDRPTTTLLLSALVPLALFCATALLSSFVIQHAFYASYIQI
ALVPAAVFAMSAAERLAPGSRRAIAGFVVAMGAAVMLVGLAIPQSVRTDPFALTVIWLLL
GLGLVAIAGLLLAARPVPALTLATCLLGLAGTANGDTASVMKLPGGADFRSQHQLLADLH
AVLIQSGVERSNYTVWFGRQDFTPRPTRAANSTWTLSFQNQPYQFNGLDSLAGSLGWSKV
WFGPALPQITAETYRLAALLTQARRPLVALCANPSVCEDGLRNLRDIGVAVEINRRLTLS
GGKSPDVAVVLAEVLVPSNDSPPMTVILAALREGLLGGPAAGAVTRGELTVARVLTVTCT
QTAAPRCDVAYLLSTGEQASTVILFRRQGALWRMVSQ