Protein Info for ABIE41_RS03050 in Bosea sp. OAE506

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 212 to 232 (21 residues), see Phobius details PF01209: Ubie_methyltran" amino acids 61 to 177 (117 residues), 27.1 bits, see alignment E=7.9e-10 PF13489: Methyltransf_23" amino acids 68 to 218 (151 residues), 61.8 bits, see alignment E=2e-20 PF13847: Methyltransf_31" amino acids 80 to 190 (111 residues), 47.1 bits, see alignment E=6.6e-16 PF13649: Methyltransf_25" amino acids 84 to 174 (91 residues), 63.4 bits, see alignment E=8.1e-21 PF08242: Methyltransf_12" amino acids 85 to 176 (92 residues), 51.9 bits, see alignment E=3.1e-17 PF08241: Methyltransf_11" amino acids 85 to 177 (93 residues), 64.3 bits, see alignment E=3.9e-21

Best Hits

KEGG orthology group: None (inferred from 43% identity to nmu:Nmul_A0287)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>ABIE41_RS03050 class I SAM-dependent methyltransferase (Bosea sp. OAE506)
MKACLTCGARAIDIDWRCLTCGYQPQSIDGFHAFAPELALENDGMSSDAHSGLDSVQDRS
FWFRARNRLIAGLVGRYASDARQVLEVGCGTGYVTMALQDVLPAASIVATEIYANGLPYA
AARLGHGVQLMQMDATRIPFVEEFDLVCAFDVVEHITDDEQAIAAMAKSLKPGGQLFLSV
PQHQWLWSQVDAFSHHKRRYARRELAQKCQRAGLSIVTQTSFVTTLLPLMFAKRLAERKR
SLVNPASEHTLPGSVDRLFAGMLDVERRLIMAGFPLPVGGSRFVLARKAA