Protein Info for ABIE41_RS02800 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 101 (101 residues), 39.3 bits, see alignment E=6.7e-14 PF00528: BPD_transp_1" amino acids 112 to 320 (209 residues), 123.7 bits, see alignment E=7.7e-40

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 75% identity to azc:AZC_2910)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>ABIE41_RS02800 ABC transporter permease (Bosea sp. OAE506)
MLAHILGRLGQALVVMLVMSALVFVGVYAIGNPIDVLIGPDVSQDIRLDTIARYGLDQPL
YVQYFTFLSRIVQGDFGRSFVFGMPVLDLILSRLPATLELTLAAVVGAALIGIPAGIYAG
YRPDGFAAKAIMTVSILGFSVPTFWIGLVLIMAFAVELQWLPAGGRGATVSVFGVEWSFL
TANGLSHLLLPACNLAFFKLALMTRLARAGTREAMLSDTVKFARAAGLSEWTVLRRHVLR
LIAIPLVTVFGLEFASTLAFAVVTETIFSWPGIGKLIIDSITSLDRPVMVAYLMLVSFVF
IMINFLVDLAYVGLDPRLRRAGSR