Protein Info for ABIE41_RS02790 in Bosea sp. OAE506

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 PF00005: ABC_tran" amino acids 30 to 188 (159 residues), 104.3 bits, see alignment E=1.7e-33 amino acids 339 to 489 (151 residues), 115.8 bits, see alignment E=4.9e-37 PF08352: oligo_HPY" amino acids 239 to 274 (36 residues), 30.3 bits, see alignment 8.9e-11 amino acids 540 to 567 (28 residues), 15.5 bits, see alignment (E = 3.7e-06)

Best Hits

KEGG orthology group: None (inferred from 66% identity to oan:Oant_4797)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>ABIE41_RS02790 ABC transporter ATP-binding protein (Bosea sp. OAE506)
MSGALQPPLLEVTDLATYFHARAGVVKAVDGVTFSLKRGEVMGLVGESGSGKSITGFSII
GLLDPQGRIERGSVRLEGRELVGLPPDELRAIRGKAISMVFQDPMMTLNPMLTIGDQIGL
ALEAHESVSGAERRRRGIAALAQVRIPDPEAKIDFYPHQFSGGMRQRVAIAIALLHRPRL
IICDEPTTALDVSIQAEILAEMKELVAELGTALIWISHDLATVASIADHVCVMRYGKIVE
AGPVLQVLTRPQHPYTQGLLDSLPSRAKPGTLLARGAGTDAAPPPRLPRQAETGRRAADL
PYVVAEAVAKRFQRKSGVLRLLAQKAGFARPLPAVQAVDHVTLSIARGEALGLVGESGSG
KSTLGRMVAGIYAPDSGHILLDGEPVMSAGDRPHKITTRIQTIFQDPFASLNPRMRIGDS
IAEGPLAHGLISRAEAGTYVAQWLAAVGLDPAFAARYPHQFSGGQRQRVAIARALAMQPD
VVVCDEPVASLDVSIQAQIINLLLRLRQELGLTLLFISHDLSVVRHLCDRVAIMHRGKIV
ESGPAGEVYDNPRDDYTKRLLAAVPVLPVA