Protein Info for ABIE41_RS02580 in Bosea sp. OAE506

Annotation: Na/Pi cotransporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 52 to 76 (25 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 180 to 207 (28 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 251 to 275 (25 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 20 to 152 (133 residues), 107.7 bits, see alignment E=5.1e-35 amino acids 165 to 234 (70 residues), 37.3 bits, see alignment E=2.7e-13 PF01895: PhoU" amino acids 349 to 427 (79 residues), 41.3 bits, see alignment E=1.6e-14 amino acids 454 to 535 (82 residues), 28.7 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 44% identity to nha:Nham_2073)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>ABIE41_RS02580 Na/Pi cotransporter family protein (Bosea sp. OAE506)
MTTNDSATMILLHLAGGVALLIWSVRLVRTGAMRAFGGSLRQALQSFTRNRFAAFGSGAL
VTIVLQSSTATTLLVSSFAGRKLIAPAMALAVLLGANLGTALAAFVISMDLGWLWGLCLA
IGVALYLGHEAMDRARNIGRILVGIGLILLALIELNAAAAPLAQSPTFRTLLSALASEPL
MAALVAVAATWLTHSSIAVILLIATFAASGLFPPATALTLVIGANLGNALIPVLDQLGSP
AAQRRAAIGNLVTRLLLALAVLPFVAPLSGWLLALPSADARLAIEFHVALNLVGALLFLP
FVTPVAALVERLMPDRDSAETEVAPRYLDPNALDSPTEALACAMREALHLGDRVEGMLRD
TMTLLEKDELKLSRAIAQADDGVDSIHEAIKLYLVRVSRNELTDEEGRRLLEIITLITNL
EHIGDIIDKNLRELAEKKIRKRYAFSPEGLAEIRDFHQRVASGLGLALNVFATRDLALAR
QLFAEKATMRDAERRATESHFERLRSGRPESIETSAIHLDIIRDLKRIHGHVASIGYPIL
ESANALRESRLMETKEARARQEREGLVSATQPGH