Protein Info for ABIE41_RS02480 in Bosea sp. OAE506

Annotation: alpha-ketoacid dehydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF02779: Transket_pyr" amino acids 4 to 178 (175 residues), 141.5 bits, see alignment E=2.3e-45 PF02780: Transketolase_C" amino acids 210 to 327 (118 residues), 127.9 bits, see alignment E=2.1e-41

Best Hits

Swiss-Prot: 74% identical to ODBB_PSEAE: 2-oxoisovalerate dehydrogenase subunit beta (bkdA2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00167, 2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC: 1.2.4.4] (inferred from 86% identity to bja:blr6332)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.4

Use Curated BLAST to search for 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>ABIE41_RS02480 alpha-ketoacid dehydrogenase subunit beta (Bosea sp. OAE506)
MPRMTMIESIRSAMDVSMGRDENVVVYGEDVGFFGGVFRCTHGLQQKYGVNRCFDAPISE
AGIVGTAIGMAAYGLRPCIEIQFADYMYPAYDQIVSEAARLRYRSNGDFTCPIVIRMPTG
GGIFGGQTHSQSPEALFTHVSGLKTVVPSNPYDAKGLLIAAIEDPDPVIFLEPKRLYNGP
FDGHHDRPVTPWSKHELGEVPEGHFSLPLGKAAIRREGSAVTIITYGTMVHVAEAVAQET
GIDAEVIDLRTLVPLDLETITASVAKTGRCMVLHEATLTSGFGAELAALVQENCFFHLEA
PVRRVAGWDTPYPHAQEWAYFPGPARVGQALREIMESR