Protein Info for ABIE41_RS02470 in Bosea sp. OAE506

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 7 to 327 (321 residues), 236.5 bits, E=1.4e-73
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 7 to 465 (459 residues), 491.5 bits, E=1.1e-151
• PF13738: Pyr_redox_3
  • amino acids 124 to 311 (188 residues), 31.6 bits, E=3.2e-11
• PF00070: Pyr_redox
  • amino acids 178 to 249 (72 residues), 67.9 bits, E=2.8e-22
• PF02852: Pyr_redox_dim
  • amino acids 346 to 455 (110 residues), 115.4 bits, E=4.5e-37

Best Hits

Swiss-Prot: 60% identical to DLDH1_PSEAE: Dihydrolipoyl dehydrogenase (lpdV) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 79% identity to bja:blr6334)

MetaCyc: 43% identical to dihydrolipoyl dehydrogenase component subunit (Bacillus subtilis)
2-oxoisovalerate dehydrogenase (acylating). [EC: 1.2.1.25, 1.8.1.4]; RXN-7716 [EC: 1.2.1.25, 1.8.1.4, 1.2.1.105]; RXN0-1132 [EC: 1.2.1.25, 1.8.1.4, 1.2.1.105, 1.2.1.104]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase (EC 1.8.1.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.8.1.4)

MetaCyc Pathways

• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• L-isoleucine degradation I (4/6 steps found)
• L-leucine degradation I (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• L-threonine degradation V (1/2 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• L-valine degradation I (5/8 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA (1/5 steps found)
• L-lysine degradation II (L-pipecolate pathway) (2/9 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)
• L-tryptophan degradation III (eukaryotic) (5/15 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (5/23 steps found)
• superpathway of L-lysine degradation (13/43 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.2.1.104 or 1.2.1.105 or 1.2.1.25 or 1.8.1.4

Protein Sequence (465 amino acids)

>ABIE41_RS02470 dihydrolipoyl dehydrogenase (Bosea sp. OAE506)
MTEITCKLLVIGAGPGGYVCAICAGQLGLDTVIVEAGRLGGTCLNVGCIPSKAMIHVAEE
YEKAAHAAAGKTPFGLTAGAPALDFAKAVAWKDGIVGRLNNGVGGLLRKAKVKIVQGRAR
FRDGKTVVVDTETGPKVIRAERIVIATGSVPVELPFLPFGGPVISSTEALSLSQVPQRLA
VVGGGYIGLELGIAFAKLGSRVTIIEAQERILPLYDAELTAPVAKRLTALGVEVLLGAKA
RGAAPAGDALLVETADGQERRIAADKILVTVGRAPVTSGIGLEELVLDMDGRFIRINDRC
ETSMRGIFAIGDVTGEPMLAHRAMAQGEMVAEIAAGLPRAWDKRAIPAVCFTDPEIVSVG
LSPDEAARAGHEVRIGQFPFAANGRAMTRDGEQGFIRIVALAQNGLVLGIQAVGCGVSEL
STAFGLAIEMGATLEDVAGTIHAHPTLGEGFQEAALKALGHAIHI