Protein Info for ABIE41_RS02420 in Bosea sp. OAE506

Annotation: OpgC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details PF10129: OpgC_C" amino acids 12 to 366 (355 residues), 304.2 bits, see alignment E=1.2e-94 PF01757: Acyl_transf_3" amino acids 15 to 362 (348 residues), 51.6 bits, see alignment E=7.9e-18

Best Hits

Predicted SEED Role

"OpgC protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>ABIE41_RS02420 OpgC domain-containing protein (Bosea sp. OAE506)
MAAPAPTSKRPRDERLDLFRGITMLIIFVAHVPANSWNAWIPARFGFSSGAELFVFCSGF
ASALAFGATFVRRGWWLGTARILQRLWQVYWAHVGLVVALVALATLLDTLVGSAELGRQF
APLMTDPERALFGLVTLTWQPDYLDILPMYLVILALIPLAIALRRLHPWLPFLMVALLYA
LVWTEGLNLPGNPWNGAGWFLNPFAWQAIFFIGFFIAMKWLPVPPLRRPGLLLAAAVFVV
VSVPFSFWGILEHWPAGRELRELLLPAASEKSNLHPLRILHFLALAYLVLSAIEPVRDRL
DAGLGHLLILIGRQSLAAFLGSIVLARLAWTASEIAGHDGLAVALLNVAGFAAILGVACV
VGWFKRAPWAGPPPASRDTPAEAPASAPSRLREAS