Protein Info for ABIE41_RS02320 in Bosea sp. OAE506

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 331 to 348 (18 residues), see Phobius details PF00892: EamA" amino acids 78 to 209 (132 residues), 41.1 bits, see alignment E=9.8e-15 amino acids 220 to 347 (128 residues), 40.9 bits, see alignment E=1.2e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>ABIE41_RS02320 DMT family transporter (Bosea sp. OAE506)
MSEDDAGARAVAFLPDEALPEPAPELVTVEASADSLAAAASILAASALPAAANALPTARA
RHRDRARGWWRAATPNLRGSLLMIAAFSAFAVMMTLIKLAGGRVPLPQILIVRQLVMTLI
LALVVGRALPRIMHTSRPGLQFLRGMFSLGAMLCGFTALIYLPMAEATALGFAQVLFVTL
LAILILGEVVDRRRWIALAIGFAGVFVMLRPGGEAMSGYALLAILGALFGAGITISVRVL
GQSERTETILFWQGAVVLIALGAPAVFLWTHPTPVEWVLMIGIGVVGTAGQWLVTRAYQM
GEASALAPLDFVRLLLATLSGYLVFAELPNLVTIVGAALVAGGTLYTMRHNAGARRLAAT
PLPDNPPA