Protein Info for ABIE41_RS02290 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 135 to 161 (27 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 76 (76 residues), 42.6 bits, see alignment E=6.2e-15 PF00528: BPD_transp_1" amino acids 114 to 317 (204 residues), 143 bits, see alignment E=9.2e-46

Best Hits

Swiss-Prot: 37% identical to APPB_BACSU: Oligopeptide transport system permease protein AppB (appB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 57% identity to rpb:RPB_0224)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>ABIE41_RS02290 ABC transporter permease (Bosea sp. OAE506)
MWHYIARRIVYAIPIAIGVTVFCFALVFLAPGNPVQMLLPADASQEVVDLIMKTYGFDRP
LPVQYWTWLTRAVVGDLGVSIQSNRPVIDEVLRALGNTIFLSFGAVALAFSIAFVLGTLA
AYYRGSATDRGVTALSIVGVSIPNYWLGIVLVIIFAVELNWLPATGMGPRGSETFNLFEW
SHFKHVILPIVTLCMVPVGMITRTTRSAVSEVLGNEFVNTLRAKGLGELAVIRHALKNAM
PQILAVMGLQFGYLMGGSILVETIFNWPGTGFLLNKAILTRDIPVLQGTILILALVFVFT
NLVVDLFQTAVDPRIKRS