Protein Info for ABIE41_RS02235 in Bosea sp. OAE506

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 263 to 280 (18 residues), see Phobius details PF00892: EamA" amino acids 10 to 141 (132 residues), 60.1 bits, see alignment E=1.3e-20 amino acids 151 to 280 (130 residues), 41.4 bits, see alignment E=8.2e-15

Best Hits

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>ABIE41_RS02235 DMT family transporter (Bosea sp. OAE506)
MAEARNTVQAGILWMILSTAFLAGGNSLVRQIATELHPFQISFLANLIMLAFVWPQLRAE
AGLPDRREKRRLYAIMTAVGCVSNLTWFYALAHVPLAKATAMTFAAPIIVTALAGVLLGE
SVSRSRWAAVLVGFVGVMVISRPGFVALDAGTIALMISTLSMASSYLISKRLTQIESTSR
IVAVTTLIPVVTGLIPAVLYWRTPSFDIMLFLVVMAVAMFVGRLTLFLALRNAPASTVMP
FDFARLPFIALFAWLAYQEIPDRWALVGAAIVMGATVFIFQDEHRKRRQVPL