Protein Info for ABIE41_RS01565 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 253 (173 residues), 43 bits, see alignment E=2.2e-15

Best Hits

Swiss-Prot: 30% identical to POTC_HAEIN: Spermidine/putrescine transport system permease protein PotC (potC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 84% identity to vei:Veis_0203)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>ABIE41_RS01565 ABC transporter permease (Bosea sp. OAE506)
MRRNGIPALIFHGLFIVFMLAPLLIVCVVAFTPEGYLSLPTRGPSLRWFKAIFDYPEFIR
AFRDSLWLAALSSTIAIMLAMPAALAIARYRFPGREAITALFMSPLMVPHVVLGIAFLRF
FTQIGISGSFVGLVLSHIIVIIPFALRLVLAASYGIDRRIEHAAISLGAGTTTVFRRVTL
PLILPGVVSGWLLAAINSFDEVTMTVFIASPATVTLPVRMFLYIQDNIDPLIAAVSACLI
AMTAILLFALDRLFGLDRLFVGSGKG