Protein Info for ABIE41_RS01370 in Bosea sp. OAE506

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 5 (5 residues), see Phobius details transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 75 to 118 (44 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 203 to 227 (25 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 310 to 333 (24 residues), see Phobius details amino acids 340 to 365 (26 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 397 to 422 (26 residues), see Phobius details amino acids 435 to 459 (25 residues), see Phobius details PF06808: DctM" amino acids 6 to 455 (450 residues), 398.5 bits, see alignment E=1.7e-123

Best Hits

KEGG orthology group: None (inferred from 72% identity to vpe:Varpa_0807)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ABIE41_RS01370 TRAP transporter large permease (Bosea sp. OAE506)
MSFKLLFLALMGSGIPVAIAMAGSSLIYILATGIAPDFVIIHRMFAGLDSFPLLAVPFFI
LAGNLMNSAGITNRIYNFALGLVGWMRGGLGHVNVVGSVIFSGMSGTAVADAAGLGTIEI
KAMREHGYDVEFAVGITAASATLGPIIPPSLPFVVYGMMANVSIGKLFLAGIVPGMVMAL
LMMATVSLYAHRNKWGGDVPFHWPRILGVLGELAIVAGFPLAIWLAVGAGVSPRIAVIAG
FALLLAADRVFRFAAVLPLMTPVLLIGGMTSGLFTATEGAIAACVWAIFLGTVWYRTLSG
RMVIKASMETVELTATVLFIVSAASVFGWVLAVSRTTEMIAGWVLAFTADPAMFLLLANA
LMLFVGCFLEPTAAITILTPILLPIVLKLGIDPVHFGLVMVLNLMIGLLHPPMGLVLFVL
ARVANLSFQRTTMAILPWLVPLLLSLALITYIPAISLWLPRVLQ