Protein Info for ABIE41_RS01145 in Bosea sp. OAE506

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 196 to 216 (21 residues), see Phobius details PF00672: HAMP" amino acids 215 to 264 (50 residues), 47 bits, see alignment 4e-16 PF00512: HisKA" amino acids 303 to 367 (65 residues), 51.7 bits, see alignment E=1.1e-17 PF02518: HATPase_c" amino acids 414 to 527 (114 residues), 88.9 bits, see alignment E=4.7e-29

Best Hits

KEGG orthology group: None (inferred from 56% identity to ccs:CCNA_01352)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>ABIE41_RS01145 ATP-binding protein (Bosea sp. OAE506)
MLFRTRLLIAFAAMGLLALAQGGFNAWISQTAERQVLRGRVAGDLQSGFLDLSATKQRLR
AWSLRVLIGADHEAGDGEMLRVRMAETIGRLQQLSREAERLDGSAGGASQDDERRDEALK
LLAASVVALQPAIATISAQGNSGNILAAWAAIEAIFDQGAGRDLRQVLNESIRTETDLLA
SRRADADRALVRLNQLSLATTVLLGLAALGLAVYFARALRRPLHDLVRGAEAFARAELDH
RIPVRGRDEFAGAATSINRMAQELSLRRDQEARIRGELEGLVAERTAALEEALDGLRQSE
RRRRQLLGEISHELRTPMAAIRGEAEVTLRGARSEAEYRAALTRVGQASQQLAALIDDLI
MMARSDGETLPLDRQPVDARLPVEEALVTVTSAAQQRQIRLETEVDTPATLFCDPVRLQQ
IITLLLDNAVRYSHPGGRVRVASQADSGGAGAGQWRLDIVDDGIGIAADDLDRVFERTYR
AGNARSHRPNGMGLGLAIARHLTERQEGTIVLDSRLGEGTTVTLRFPIIGEGQAFPREQS
A