Protein Info for ABIE41_RS00270 in Bosea sp. OAE506

Annotation: penicillin-insensitive murein endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03411: Peptidase_M74" amino acids 64 to 312 (249 residues), 336.8 bits, see alignment E=3.9e-105

Best Hits

KEGG orthology group: K07261, penicillin-insensitive murein endopeptidase [EC: 3.4.24.-] (inferred from 65% identity to mno:Mnod_1139)

Predicted SEED Role

"Murein endopeptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>ABIE41_RS00270 penicillin-insensitive murein endopeptidase (Bosea sp. OAE506)
MPRLHRRIAAACLVVAALLPAVARAQSTADEEAKRRAANIAAFPDAARALFGQKTAPASL
QARAIGSYARGCLAGATALPVDGPSWQVMRLNRNRNWGHPVLIEYLEDLAREVPRITGWP
GLLVGDISQPRGGPMLTGHASHQIGLDADLWLTPMPRGRLDREARENMPAVNMARADWRD
VDPKHWTPAHTRLIRTAASEPRVERIFVNPAIKVALCREAGADRTWLNKVRPIWGHNYHF
HIRMSCPAGMASCSGQEPPNFGDGCGQELTDWIERQRAAIFAPPKPPRTGPAPKPKPPMS
LDDLPAECRQVLVSR