Protein Info for ABIE41_RS00160 in Bosea sp. OAE506

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>ABIE41_RS00160 hypothetical protein (Bosea sp. OAE506)
MGLATDDVARSLRGSWQLMTRGEAALDELDLSREGFWRSYLALALMLPATIAILAAVRLH
AGLPNTEGLFESPALALAVMTAGLASILAVPALLIVLAPNLVRAQRFTSFVIAWNWAGIV
SASLMAVPATVFAIGWSNDDIAFVQMIAFAVIVLRLRYCVARAAFGAASRVAAPVVLASV
IADYAVLRLFGLLG