Protein Info for ABIE40_RS30910 in Rhizobium sp. OAE497

Annotation: ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 11 to 231 (221 residues), 276.1 bits, see alignment E=9.9e-87 PF00116: COX2" amino acids 143 to 216 (74 residues), 30 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 47% identical to QOX2_ACEAC: Ubiquinol oxidase subunit 2 (cyaB) from Acetobacter aceti

KEGG orthology group: None (inferred from 52% identity to mci:Mesci_6327)

MetaCyc: 42% identical to cytochrome bo terminal oxidase subunit II (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ABIE40_RS30910 ubiquinol oxidase subunit II (Rhizobium sp. OAE497)
MAPNILLLLSLGAPLSSCSLAILDPLGPVGRGNAQILIDATIIMLAIVIPTIALAFWTAW
RYRASNKKADYLPYWSYSGRIEAVVWSIPILTIMFLSGLIWIGSHELDPFRPLPSKAPTL
EVQVVSLDWKWLFIYPEEKVASVNQLVIPAGRPVHFSITSASVFNVFFVPRLGSMIYAMP
GMTSQLYLQADRPTQIWGTSAQFSGDGFSDMQFNVHSLTEDEFAKWIDHAKLAGPVLDQS
SYSDLLHQSQRMTPTVYGKADPHLFHLIANQTVASGAGPQPEAPDHAGRETSTGGKH