Protein Info for ABIE40_RS30725 in Rhizobium sp. OAE497

Annotation: NADH-quinone oxidoreductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF00329: Complex1_30kDa" amino acids 34 to 152 (119 residues), 164.1 bits, see alignment E=1.1e-52 TIGR01961: NADH (or F420H2) dehydrogenase, subunit C" amino acids 35 to 151 (117 residues), 151.2 bits, see alignment E=9e-49

Best Hits

Swiss-Prot: 73% identical to NUOC_RHIL3: NADH-quinone oxidoreductase subunit C (nuoC) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K00332, NADH dehydrogenase I subunit C [EC: 1.6.5.3] (inferred from 75% identity to rlg:Rleg_5798)

MetaCyc: 47% identical to MbhK (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>ABIE40_RS30725 NADH-quinone oxidoreductase subunit C (Rhizobium sp. OAE497)
MSQLIGYLSHVLAHQKNAVISSQCERGELSILTTPACVIELVRFLRDDEHGQFICLLDIC
GVDWPAREKRFDVVYHLLSPHKNMRVRVKLAADEETLVPSLCPLFPNADWYEREAWDMYG
ILFTGHPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYDDAAKRVIYEPVELRQEYRDFDF
LSPWEGTEYILPGDEKSGEPGSDTKAP