Protein Info for ABIE40_RS30725 in Rhizobium sp. OAE497

Annotation: NADH-quinone oxidoreductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00329: Complex1_30kDa
  • amino acids 34 to 152 (119 residues), 164.1 bits, E=1.1e-52
• TIGR01961: NADH (or F420H2) dehydrogenase, subunit C
  • amino acids 35 to 151 (117 residues), 151.2 bits, E=9e-49

Best Hits

Swiss-Prot: 73% identical to NUOC_RHIL3: NADH-quinone oxidoreductase subunit C (nuoC) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K00332, NADH dehydrogenase I subunit C [EC: 1.6.5.3] (inferred from 75% identity to rlg:Rleg_5798)

MetaCyc: 47% identical to MbhK (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (3/6 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (2/9 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism
• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Protein Sequence (207 amino acids)

>ABIE40_RS30725 NADH-quinone oxidoreductase subunit C (Rhizobium sp. OAE497)
MSQLIGYLSHVLAHQKNAVISSQCERGELSILTTPACVIELVRFLRDDEHGQFICLLDIC
GVDWPAREKRFDVVYHLLSPHKNMRVRVKLAADEETLVPSLCPLFPNADWYEREAWDMYG
ILFTGHPDLRRILTDYGFEGHPLRKDFPLTGFVEVRYDDAAKRVIYEPVELRQEYRDFDF
LSPWEGTEYILPGDEKSGEPGSDTKAP