Protein Info for ABIE40_RS30360 in Rhizobium sp. OAE497

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 181 to 207 (27 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details PF05992: SbmA_BacA" amino acids 30 to 342 (313 residues), 63.8 bits, see alignment E=3e-21 PF06472: ABC_membrane_2" amino acids 35 to 297 (263 residues), 124.4 bits, see alignment E=8.6e-40 PF00005: ABC_tran" amino acids 391 to 525 (135 residues), 76.9 bits, see alignment E=3.7e-25

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 79% identity to rlg:Rleg_0163)

Predicted SEED Role

"putative ABC transporter (fused ATP-binding and permease components)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>ABIE40_RS30360 ABC transporter ATP-binding protein/permease (Rhizobium sp. OAE497)
MEDARKAYLLRRFWISGREYWGRNGDRLAWASSIGLLLLIAINVAFQYGINVWNRGLFDA
IEQRNASTVYFLGAVFPPLVLGCVAVVTIQVYVRMLIQRRWRSWLTKALIARWLANGRYY
QLNLIGGDHQNPEARLSEDMRIATESPVDFVAGVIAAFVSASTFIVVLWTIGGALRLPIA
GMTITIPGFLVVTAVIYALVTSGSITFIGRRFVRVSEAKNQVEAEFRYTLTRVRENGESI
ALLGGEEEERNDLDKTFASVRQQWRLLAHQHMRTTLVSHGSMLIAPVVPVLLCAPKFLDG
SMTLGQVMQAASAFTIVQSAFGWLVDNYPRLADWNASARRVASLMMSLDGLENAEKSQSL
DRIKHGETEGETMLSLNDVSVALGDGTAVVKETQVEVGPGERVLVAGESGSGKSTLVRAI
AGLWPWGGGSVNFHPGKQLFMLPQRPYIPSGTLRRAVSYPQPADSHTEDELQTALEKVGL
GHLIEKIEEDAPWDHTLSGGEKQRLAFARLLLNDPDIIVLDEATSALDEKTQDKIMEMLI
DELPDATIVSVAHRAELEAFHSRKITLEKREGGARLVSDVDLAPYRKQRNVLTKLTKYSR
KLKKVP