Protein Info for ABIE40_RS29890 in Rhizobium sp. OAE497

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 24 to 172 (149 residues), 137.7 bits, E=6.4e-44

Best Hits

Swiss-Prot: 76% identical to AAPP_RHIL3: General L-amino acid transport ATP-binding protein AapP (aapP) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K09972, general L-amino acid transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 80% identity to pfv:Psefu_1067)

MetaCyc: 60% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Protein Sequence (248 amino acids)

>ABIE40_RS29890 amino acid ABC transporter ATP-binding protein (Rhizobium sp. OAE497)
MTFNPRPEIELTGVNKWYGEYHALNEINLTIRKGERVVICGPSGSGKSTLIRCINRLEVH
QRGRIVVAGTELSENERNIGDIRREVGMVFQHFNLFPHLTILENCILAPVWVRKMDKRKA
TEIAMHYLERVRIPEQAGKYPGQLSGGQQQRVAIARALCMQPKVMLFDEPTSALDPEMVK
EVLETMVSLAETGMTMVCVTHEMGFARQVADRVIFMDRGAIVEEAAPAAFFDNPQNDRSK
LFLSQILH