Protein Info for ABIE40_RS27205 in Rhizobium sp. OAE497
Annotation: IS110 family transposase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to TPF20_PSEAE: Probable family 20 transposase (PA0445) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: None (inferred from 50% identity to nha:Nham_1959)Predicted SEED Role
"Mobile element protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (294 amino acids)
>ABIE40_RS27205 IS110 family transposase (Rhizobium sp. OAE497) MPPCVVAMESCATAHHWGRSIAALGHEVRLIHPTYVKPFVNRDKTDANDAEAIHAASSRK SMRFVPVKSAGHQASTMLFKTRALLVRQRVQAVNALRAHLAEFGIVSRPGAANVPTLVAA VRNRTNTILPPQARAALRIIAKQIDRLSQDIAGLEKALKAHAKADDEMRRLMTIPGVGPM TATAVKAFVPDAKIFKSARHFASWTGLTPRTLSSGERTWTGGITKRGNCELRSLIVAGAM SVVRNTKEDARSWVASLKRRRPFKVAAVALANKIARTIWALLVNGGIYNPELLA