Protein Info for ABIE40_RS26305 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 193 to 223 (31 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 74 to 271 (198 residues), 44.2 bits, see alignment E=9.5e-16

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 97% identity to mes:Meso_1095)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>ABIE40_RS26305 sugar ABC transporter permease (Rhizobium sp. OAE497)
MHRLYVLPTLIINVVIIAIPALLTVALAFFEWDGISTPVFVGLDNFRALWDDSVFWTALT
NNIVWTLIFLTVPIAMGLLAATMMLVVRRGSNFFQVIYFLPVIIATAITGRVWQGMIYSP
VTGVTGLLQRLGLDIANPLTETSSALYGIAVVDLWHWWGFLCVIFFAALRQVPAEQIEAS
RIEGATFFQTIRYVLLPGIMPTITLMMIMTVIWSFLVFDFVYILTQGGPAYSSEVLSTFA
YRSAFYDLAVGKAAAISVVISLFGLAATIFYIRAQATEFEQ