Protein Info for ABIE40_RS26285 in Rhizobium sp. OAE497

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 56 to 83 (28 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 315 (271 residues), 142.6 bits, see alignment E=6.9e-46

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 82% identity to smd:Smed_4737)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ABIE40_RS26285 ABC transporter permease (Rhizobium sp. OAE497)
MLSALIRPFAPKSSGDLARLGVLIALAALILFGALRYDNFLSPFNILSFLRYNSMFALIA
LGMAFVIMTGGIDLSVGGVAALASVVSALASPYGWAAGLAAGIGAGLVVGMLNGFVISKM
RIQPFIATLAAMLAAYGTALLLADNQSVSVDYDTAFVSIGQDDFLGFPIPGWIALAAYVA
GWIFLERRPSGRHILAIGDGEQTAALMGLKVNRTLFAIYALSGALAGLAGVILAAQFGAG
QPTEGVGWELFAIASVVVGGTLLTGGSGSVGATLAGALLLGMVFNVLNFENGLGWISLSA
YWQSVIRGAFLLVVVILQARLTAKSAA