Protein Info for ABIE40_RS26280 in Rhizobium sp. OAE497

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 173 to 199 (27 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 55 to 323 (269 residues), 138.2 bits, see alignment E=1.5e-44

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 81% identity to ara:Arad_12138)

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YtfT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>ABIE40_RS26280 ABC transporter permease (Rhizobium sp. OAE497)
MTMTDTSLKAAAPPRPSALQIASRYGTFAAFLLLIAVNVAITPNFLSWQTLNVNLTQVAT
IVIVATGMTLVIATGGIDLSVGSLMAISGAVAPMIFLGTLVPIDNAALAVGLAFVLPVIV
AMLFGWFNGFLVTHFSIQPIVATLVLFIAGRGIAQVMTNGNLQVFKNPAFQWIAMGNVAG
IPAQVLLMVVIAALAYCLIRFTVIGRQIIAVGGNEKAARLTGIPVKRVKTLVYVISGALA
GIAGLVVVARNSASDANLVGMGMELDAIAAVAVGGSLLTGGRANIFGTLLGAFVIQLVRY
TLLANGVPDAAALVVKAGLIVVAVFIQQRADKT