Protein Info for ABIE40_RS26275 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 19 to 167 (149 residues), 111.7 bits, see alignment E=9.2e-36 amino acids 271 to 424 (154 residues), 77.1 bits, see alignment E=4.3e-25

Best Hits

Swiss-Prot: 43% identical to RBSA3_RUBXD: Ribose import ATP-binding protein RbsA 3 (rbsA3) from Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 80% identity to smd:Smed_4739)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>ABIE40_RS26275 sugar ABC transporter ATP-binding protein (Rhizobium sp. OAE497)
MLLSMQGISKSFAGIAALRSASLDIAEGEIMALVGQNGAGKSTLIKILTGAYQRDEGSIR
FNGEDVAFSTPAESQAAGIATIYQEINLAPQRSVAENIYLSREPKKFGFLDRRAMREGAR
KVLATFNLDIDVDLPVSRFSAATRQMVSIARAVTQNARLLIMDEPTSSLDEREVAVLFET
IRTLQKSGVAVIFIGHRLDELYAICDRVTIMRDGQTVAVSAMKDIPKMELVRHMLGRELA
AFEALSRDADNAIERPVRLELEGAGSGLRVRDVDLLIREGEISGLAGLLGSGRTETARII
FGVDKLERGSLRFGGTDRNYAEPAAAIADGIGLVSEDRKVDGIVPDMSIRENMTLALLPK
LKRAGIVDRARQDEIVARFIKSLGVKCASPDQPIKELSGGNQQKVLLARWLCTDPRVLIV
DEPTRGIDIGAKSEILRLLRNLADEGLSVLMISSELEELLAAADRVTVLSDGASVAVLPR
RELSEQSLLAAMAHQVD