Protein Info for ABIE40_RS25945 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 226 to 251 (26 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 88% identity to rle:RL2326)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>ABIE40_RS25945 sugar ABC transporter permease (Rhizobium sp. OAE497)
MAEISVSSGVRTAPPSKAARKNRSSIAHDRWAVLLLFLPPALILFTLFVIMPMGEAAWYS
LYKWNGYGTPTEYIALKNFQVLFRNAAFSQALINNGLIIVVSIAIQVPLAIWLSTMLAHR
IPGVVTYRLIFFLPYVLADVAAGLIWRFVYDGDYGLFAAIAGFFGMANPYVLADKDVAIY
AVLGVVVWKYFGFHMMLFIAGLQSVDKNVLEAADIDGASGWQKFRYITLPLLGSTLRLSI
FFAVIGSLQLFDMIMPLTGGGPSNSTQTMVTFLYTYGVMRMQVGLGSAVGVVLFIICVTL
AFGYKRIFMRND