Protein Info for ABIE40_RS25800 in Rhizobium sp. OAE497

Annotation: Ldh family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02615: Ldh_2
  • amino acids 10 to 337 (328 residues), 269.5 bits, E=2.1e-84

Best Hits

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 52% identity to vei:Veis_4538)

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle III (animals) (9/10 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• homolactic fermentation (10/12 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• L-histidine degradation V (1/2 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• heterolactic fermentation (12/18 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• gluconeogenesis III (7/12 steps found)
• pyruvate fermentation to acetate and lactate II (1/4 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• reductive TCA cycle II (6/12 steps found)
• methylaspartate cycle (11/19 steps found)
• mixed acid fermentation (8/16 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• formaldehyde assimilation I (serine pathway) (5/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (9/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (18/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Citrate cycle (TCA cycle)
• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Glyoxylate and dicarboxylate metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.27 or 1.1.1.37

Protein Sequence (350 amino acids)

>ABIE40_RS25800 Ldh family oxidoreductase (Rhizobium sp. OAE497)
MADTTETLYQADKLRAFATSLFAAAGLEDDKAEAVSRFLVEADLLGHTTHGLALAGWYLQ
SIADGVMKVSGAPDVISDRGPAIAWNGKRLPGAWLTSEAVKLASDRAAQYGTATVAIADS
HHIGCLAAYLTLATDRGYMVSIASSSPSGAQVAPFGGTRGIYTPNPVAHGIPTPGDPILI
DISASITTVNMAQRLIREGRQYEHDWLLDENGNPSRDPRVIERGGTLLPTGGLDHGQKGY
GMALHVEAFTQGLAGYGRVDSPKGTNAAVTVQVFDPEAFGGREAFLRQTGWLADACHNNP
PRPGVARVRLPGENGLARKRKALTDGVALFPGIMASLKPHAERLGVALPA