Protein Info for ABIE40_RS25550 in Rhizobium sp. OAE497

Annotation: nitrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 87 to 284 (198 residues), 307.3 bits, see alignment E=2.4e-96 PF00528: BPD_transp_1" amino acids 121 to 279 (159 residues), 99.4 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 61% identical to NRTB_SYNY3: Nitrate import permease protein NrtB (nrtB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 83% identity to rle:pRL100345)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ABIE40_RS25550 nitrate ABC transporter permease (Rhizobium sp. OAE497)
MSALAKNEPITPAQPAPKTANVVRLTKAPSRRVNVRQLATAAARNVVPPLVVLALMLGVW
QILCSSPTASLPSPHQVWQESYDLIAFPFFNYGSQDIGLGWRVLVSLQRVAYGFGLAAVA
GIVMGAIIGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDSNPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVAQVLRLNQIEFFFKIMLPSAAPYIFTGLRIGVGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVVGFALDKLVAAAGRLITRGASAN