Protein Info for ABIE40_RS25305 in Rhizobium sp. OAE497

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 98 to 129 (32 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 66 to 326 (261 residues), 140.8 bits, see alignment E=2.4e-45

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 92% identity to sme:SMa0217)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABIE40_RS25305 ABC transporter permease (Rhizobium sp. OAE497)
MTPILAESAAPRSRTQKQSILKQIMGKPAGAIFLVFMTLQIVCIVGALLYPDDFRYLSPQ
NLTILMKAIPVLGCLALGAGVLMISGEFDLSIGSVYTFTAILMASLVNLGISAFIAAPIG
ILAGVMIGLLNGQITLRFGLPSFIVTLGGLLFWRGAVLLYNGAVQVRFDPEAAFTSLFSG
SLFGINAAFIWIILLVAAFHLLLHSHRFGNHVFATGGNRGAAEAIGINTGRVKLIGFAIA
GGMAAVAGILATTRVGSVQPGQGAGLELQAIAACVIGGLSLRGGRGSIIGIFLGVLLIHT
ITDVLLLLRAPGFYLDMFIATLIVLAAIFNHLIERRGLA