Protein Info for ABIE40_RS25025 in Rhizobium sp. OAE497

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 265 (180 residues), 61.4 bits, see alignment E=4.9e-21

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 89% identity to smd:Smed_0188)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>ABIE40_RS25025 carbohydrate ABC transporter permease (Rhizobium sp. OAE497)
MKKPGTLRRILTTDLPVALLVIFAMAPFAWMILTSMTPTAALNASGVSLSPAGWSADNYV
RLFEQTSFLKNMMDSLIIAGGTVVVGLIVSVTAAYAFSRFRFPGRKLLMLQFLLINMFPI
VLLILPLFVLMRKFGILDTHLGLILANATVAIPFAVWMLTSYIGAIPKSLDEAAMTDGAS
RLTALRKVVLPLTMPGIISTGIYIFITAWNEYLYALTLGGRNVRPVTVAIQTLIGEYQIE
WGLLAAGAVVGAMPATILFLLVQRRLIGGLTQGAVKG