Protein Info for ABIE40_RS24745 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF00005: ABC_tran" amino acids 31 to 180 (150 residues), 116.1 bits, see alignment E=2e-37 amino acids 287 to 440 (154 residues), 75.9 bits, see alignment E=4.9e-25

Best Hits

Swiss-Prot: 41% identical to XYLG_PHOPR: Xylose import ATP-binding protein XylG (xylG) from Photobacterium profundum (strain SS9)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 92% identity to rlg:Rleg_5321)

MetaCyc: 81% identical to putative erythritol ABC transporter ATP-binding protein (Brucella abortus 2308)
7.5.2.-

Predicted SEED Role

"Predicted erythritol ABC transporter 2, ATP-binding component" in subsystem Erythritol utilization

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>ABIE40_RS24745 sugar ABC transporter ATP-binding protein (Rhizobium sp. OAE497)
MSQPLRNPGTQGEVVLAARNIAKSYGNVHALKGVNFDIHRGQVTTLFGENGAGKSTLMKI
LSGVVQPTSGEIVLDGSPISFASSTHARECGISIIHQELSLAPNLSVRDNIFMGREIITG
GMVDFAEEERQTRALMEELEEDIDPLTRVEDLRLGQQQIVEIARALSVNSRILIMDEPTS
ALSATEVEVLFKVIHDLTGRGVSIVYISHHLEEALQITNHAVVLRDGTMTAYAERKDIDL
EWIVRNMVGDNFDLGSPPEGHQFGEVALSIEGLTVPGPSGAAYNAVDRMSLKVRAGEVVC
IYGLMGAGRTELLECVAGRLRSSGGRVLLEGQDVGALSIAGRIESGLVLVPEDRQRDGLV
QTMTVGSNLSLASIGAFTKGLFTSGRRERDLVTESIRRVHVKTDGGEAAIGSLSGGNQQK
VVIGKMLATEPKVILLDEPSRGIDIGAKAEVFKLLAERAKQGLAVIYSTSEVNECLSIAH
RIIVMHRGRISAEFSSDVTKEKIMAASGESMVAH