Protein Info for ABIE40_RS24630 in Rhizobium sp. OAE497

Annotation: potassium-transporting ATPase subunit KdpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 421 to 443 (23 residues), see Phobius details amino acids 486 to 509 (24 residues), see Phobius details amino acids 529 to 552 (24 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 560 (560 residues), 759.7 bits, see alignment E=9.2e-233 PF03814: KdpA" amino acids 11 to 559 (549 residues), 809 bits, see alignment E=8.4e-248

Best Hits

Swiss-Prot: 89% identical to KDPA_AGRFC: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 89% identity to rle:pRL110381)

MetaCyc: 53% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>ABIE40_RS24630 potassium-transporting ATPase subunit KdpA (Rhizobium sp. OAE497)
MTLNGWLQILVFCGILIALVKPLGGYMTRVFSGERTLLSPVLVPVERGLYALAGTSEREE
QHWTSYAFAMLLFNLFGVLVLYALMRLQAVLPYNPAGMAAVGPELSFNSAVSFVTNTNWQ
NYGGESTMSYLTQMMGFTVQNFVSAATGMAIAMGLIRAFSRASGKAIGNFWVDMIRATLY
VLLPFCIVLTLIYVWLGVPQTLGPYVDAATLEGAKQTIALGPVASQLAIKMLGTNGGGFF
NANSAHPFENPDNISNMIQMLSIFAIGAAFTNVFGRMVGNQRQGWAVLASMGLLFIVGVA
ITYWAEAAGNPLMHAFGLGGGNMEGKEVRFGIAMSSLFAVITTAASCGAVNAMHGSFTAL
GGLIPLINMQLGEVIVGGVGAGFYGIILFIIIAIFVAGLMVGRTPEYLGKKIEAKEMKMA
VLAILCLPLAMLVFVAIASVLPSAVASVGTAGPHGFSEILYAYTSAAANNGSAFGGLTGN
TPWYNVTLGIGMLMGRFLVIIPALAIAGSLVAKKTVPASAGTFPTDGPLFVGLLVGTILI
VGGLTFMPALALGPVVEHLVMTAGQTF