Protein Info for ABIE40_RS24460 in Rhizobium sp. OAE497

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 193 (27 residues), see Phobius details amino acids 214 to 239 (26 residues), see Phobius details amino acids 251 to 275 (25 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 124 to 297 (174 residues), 49.9 bits, see alignment E=1.7e-17

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 50% identity to lch:Lcho_4323)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>ABIE40_RS24460 carbohydrate ABC transporter permease (Rhizobium sp. OAE497)
MTMITQAATLEDAANALPTQRGPFFPRKKKRIAGRSIAILVFLTICALFFCVPLYVVVVT
SFKTMDQIREGAIFSLPHVWTLEAWDHAWNKACSGINCNGLKVGFWNSVLILFPSLILSI
ALSIVTGYALALWNVRWANAFLFLLFICAFVPFQVIMYPLIRITASIGIYGTLWGIAAVH
AVLAMPVLTLIFRNYYKDIPQEIIRAAIIDSGSFWRIFIEIILPMSGNILIVVLILQITS
IWNDYLIGVTFGGLGTQPMTVILANLITVSTGVVAYNDNMAAALLTAIPPLVIYFLVGKF
FVQGITAGAIKG