Protein Info for ABIE40_RS24455 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 201 to 226 (26 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 293 (211 residues), 58 bits, see alignment E=5.3e-20

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 46% identity to kvu:EIO_3046)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>ABIE40_RS24455 sugar ABC transporter permease (Rhizobium sp. OAE497)
MQLRWSRVAPQLALAPAVAVTMVAFIGAIGWTVWLSFTRSRRMPEYEIDWTDWTRQYARL
FNDGGWAISLQNLIILGLGSALAIVFGFVLAAMIDREWRGESFFRTVFLYPLAVSLIVTG
AAWRWIFNPQLGLENFLHGLGFTSVSFNWLASPDTAMYAIILASIWQSSGFYMALMLAGL
KSINTEIWSAARLDGVSFWRLYIEIIIPMMKFTFITCAILLSLGVIKAYDVVVAMTNGGP
GNSTWVPAYFTINALSAKSNIGYASAAAITMLVITALIFLPLVLITAWQQRRVNGGGA