Protein Info for ABIE40_RS24220 in Rhizobium sp. OAE497

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 43 to 378 (336 residues), 271.2 bits, see alignment E=5.1e-85 PF16576: HlyD_D23" amino acids 67 to 296 (230 residues), 49.7 bits, see alignment E=5.9e-17 PF13533: Biotin_lipoyl_2" amino acids 70 to 107 (38 residues), 30.4 bits, see alignment 5.4e-11 PF00529: CusB_dom_1" amino acids 118 to 364 (247 residues), 34.4 bits, see alignment E=3.4e-12 PF13437: HlyD_3" amino acids 178 to 293 (116 residues), 34.8 bits, see alignment E=4.5e-12

Best Hits

Swiss-Prot: 49% identical to ACRA_ECO57: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli O157:H7

KEGG orthology group: K03585, membrane fusion protein (inferred from 78% identity to ara:Arad_9282)

MetaCyc: 49% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>ABIE40_RS24220 efflux RND transporter periplasmic adaptor subunit (Rhizobium sp. OAE497)
MPIAKTRWLANLGYATALTLALASCNEQAPQQQKAAADAKPQVSAVTLRPQSVTITAEVP
GRTAASLIAEVRPQVGGIIRARNFKEGSEVNAGDVLYEIEPSPYQAAFDSSVATLQKAEG
AVPSAQAKVDRYQGLTSQAAVSKQDLDDARSTLAQALADVASARAALETARINLGYTKIR
APIGGRIDASAVTVGALVTAEQTTALATINQLDPINVDVTQSSTNLLALRKSIAEGRIKT
TGDNVSVNVKLEDGSKYDKPGKFEFLESSVSQTLGTVTARATFPNPDRLLLPGMYVRATI
EEGVAPNSFLVPQRAVTRDTKGDPTAMFVSTDGKVQRRTLSVQRSIGNSWLVAGGINDGD
RVIVEGIQRVRDGQDVKVDDVTLDDATGEIKQADAAEAAPVKEAANTPVTK