Protein Info for ABIE40_RS23995 in Rhizobium sp. OAE497

Annotation: class II aldolase/adducin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00596: Aldolase_II" amino acids 10 to 184 (175 residues), 186.1 bits, see alignment E=3e-59

Best Hits

Swiss-Prot: 48% identical to ALD2_RHORT: 5-(methylthio)ribulose-1-phosphate aldolase (ald2) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 60% identity to mci:Mesci_0262)

MetaCyc: 48% identical to 5-(methylthio)ribulose-1-phosphate aldolase (Rhodospirillum rubrum)
RXN-21316 [EC: 4.1.2.62]; 4.1.2.62 [EC: 4.1.2.62]

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.17 or 4.1.2.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>ABIE40_RS23995 class II aldolase/adducin family protein (Rhizobium sp. OAE497)
MTETSEHLRQSLVDASREAEALRLNAGTSGNISVRTDKGMLITPTGVPSKSLRNEMIVEM
DLDGAWSGEMTPSSEWALHAAIYKARPEVQAIVHAHPDNCVALSCAREPLPAFHYMIAGF
GGDDIRCSKYAAFGSPELAGVTVEAIEGRTACLLANHGMVAVGATVAEAFGRTVKLETLA
RQYILCRSFSQPVVLTPDDLVEVKERYKTYGRQPVRAS