Protein Info for ABIE40_RS23890 in Rhizobium sp. OAE497

Annotation: calcium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 49 to 201 (153 residues), 60.4 bits, see alignment E=1e-20 amino acids 233 to 374 (142 residues), 42.3 bits, see alignment E=3.8e-15

Best Hits

Swiss-Prot: 38% identical to CHAA_ECOLI: Sodium-potassium/proton antiporter ChaA (chaA) from Escherichia coli (strain K12)

KEGG orthology group: K07300, Ca2+:H+ antiporter (inferred from 72% identity to rlg:Rleg_3806)

MetaCyc: 38% identical to Na+/K+:H+ antiporter ChaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-101; TRANS-RXN-42

Predicted SEED Role

"putative cation/proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>ABIE40_RS23890 calcium:proton antiporter (Rhizobium sp. OAE497)
MTNSLAVPSFGIARLLREEWFLGIGLVTSAIILLFEDALFDHLTNPAWFAVIFLWIFAAV
LGSALSVVRHADHLAEQLGEPYGTLILTLAITSIEVMAISAVMIHGANNPTLARDTLFAV
VMIILNGMVGLSLLVGGWRRPEQQHNMQGANAYLGLIVPLAALSLILPSFIHADGSQAST
PRQMILVVISVGLYSIFLMLQAGRHHRYFSEEGEAGQPKHRAPLRKGAILLHALLLFAYM
VPVVFLVEQLARPIDYIIETVHAPAAIGGIIMAVLVATPEALSAVRASIANNLQRSVNIF
LGSVLSTIGLTVPAMLLVAHISSHPIRLGLEGTDLVMLTLTLAVNMITFASGRTHMMQGA
VHLVLFLAYVLLIFQP