Protein Info for ABIE40_RS23880 in Rhizobium sp. OAE497

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 32 to 366 (335 residues), 267.2 bits, see alignment E=8.4e-84 PF13533: Biotin_lipoyl_2" amino acids 54 to 102 (49 residues), 36.2 bits, see alignment 7.9e-13 PF16576: HlyD_D23" amino acids 54 to 285 (232 residues), 73.1 bits, see alignment E=4.2e-24 PF13437: HlyD_3" amino acids 164 to 282 (119 residues), 23.4 bits, see alignment E=1.7e-08 PF00529: CusB_dom_1" amino acids 181 to 352 (172 residues), 26.3 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 36% identical to ACRE_ECOLI: Multidrug export protein AcrE (acrE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 73% identity to rle:RL4274)

MetaCyc: 36% identical to multidrug efflux pump membrane fusion lipoprotein AcrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-367

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>ABIE40_RS23880 efflux RND transporter periplasmic adaptor subunit (Rhizobium sp. OAE497)
MLAALLCAAGLTACDGNGNTYVAPPPAKVRMAQPLQQNVTKYFELTGNTAAFKSVDIEAR
VQGFVETIDYRDGTAVKAGDKLFGIQSNTYQAQLDQAQATLTSAQAAQVGANQEYTRQVN
LSAQKVGTQTALDNAKATLDQANATILNAQASLELAKINLGYTTVTAPFDGTVTAHLVEI
GTLVGVSGPTTLATIVQLDPLYANFNVSESQVLMIKRELAAQGHTFKQTDLPNIPIEMGL
QGETDYPFKGHLDYAAPQVDASTGTLAVRGVVENKDRALLPGLFVRVRVPVGHEDKALLV
RDDAIGINQQGNYVLVVGKDDTVEQRPVKTGQSEGRLRVIESGLSAGDWVVTEGFQQAVP
GNKVAPEKATMEIPATADASGAAAPQAGAQ