Protein Info for ABIE40_RS23525 in Rhizobium sp. OAE497

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 transmembrane" amino acids 77 to 99 (23 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 333 to 337 (5 residues), see Phobius details amino acids 359 to 373 (15 residues), see Phobius details PF05992: SbmA_BacA" amino acids 78 to 392 (315 residues), 49.6 bits, see alignment E=6.1e-17 PF06472: ABC_membrane_2" amino acids 84 to 346 (263 residues), 117.7 bits, see alignment E=9.6e-38 PF00005: ABC_tran" amino acids 440 to 574 (135 residues), 72.5 bits, see alignment E=8.4e-24

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 82% identity to rlg:Rleg_0163)

Predicted SEED Role

"putative ABC transporter (fused ATP-binding and permease components)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (657 amino acids)

>ABIE40_RS23525 ABC transporter ATP-binding protein/permease (Rhizobium sp. OAE497)
MAEAQLKPKSVDGTKPEGAAKSHQGEGSTVEAPPPPDIAEPDPGLTPEEAEHARKRYLLR
RFWISARGYWSRHGDSFAWPCTLGLLAMIVLNVGFQYGINLWNRKIFDAIERHDAGTVYY
LSAVFLPLVLGSVALVTAQVLVRMMIQRRWRSWLTKAVIQRWLANGRYYQLNLIGGDHAN
PEARISEDLRIATESPVDFIAGVIVAFLSASTFIVVLWTIGGALTLPVGGSMITIPGFLV
VAAVLYAGITSTSIAFIGRNFVAVSEVKNQTEAEFRYTLTHVRENGESIALLGGEEEERN
DVDRTFGKVIRQWALLAGQHMRTTLVSQGSSLIAPVVPILLCAPKFLEGAMTLGEVMQAA
SAFTIVQAAFGWLVDNYPRLADWNASARRIASLMMSLDGLERAEHNDSLGRIQHGETEGE
AMLSLNDLSVSLDDGTSVVKETQVDIEPGERVLVSGESGTGKSTLVRAIAGLWPWGQGSV
NFRAGSRLFMLPQRPYIPSGTLRRATAYPRAADDWSEEEIKGALKAVGLDYLSARIEEEA
PWDQTLSGGEKQRLAFARLLLHDPDIIVLDEATSALDEKSQDQMMQTIIRELPKVTIVSV
AHRAELEAFHSRKITLERRDGGAKLVSDIDLIPRKRKSKSLLRRMVPRHSRSKRSGR