Protein Info for ABIE40_RS22795 in Rhizobium sp. OAE497

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 63 (25 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 41 to 316 (276 residues), 129.1 bits, see alignment E=9.1e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 89% identity to mlo:mll8565)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>ABIE40_RS22795 ABC transporter permease (Rhizobium sp. OAE497)
MTPRTRQFFELVLDNLVWFMLIFVLAVFSALVPNYFQLGIFANIIEASSVLGVMSIGLAL
VIIAGHMDLSVESVAALSAMAVGILFCSAGIGMGFTLSPEWLMVPVSLLIALAVGGLIGL
LNGFLIVKVKMNAFIITLASYIWVRGIVLAVSGGRSAQDLAPAIRWFGIQRLIGLPLTAW
IAIACFIVFSVMMAKTPFGRHLTMIGGNETATFRAGIPVQRNLIIAFVMAGAIAGLAGWL
LAIRTSGATANLGVGLLFNAFAAVVIGGVSLKGGVGALPGVYAGVLLLSSINTAINLMGL
PANFTQVIHGFLVLAAVLLDTFKQKLRQRLA