Protein Info for ABIE40_RS21870 in Rhizobium sp. OAE497

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 261 (177 residues), 74.6 bits, see alignment E=4.2e-25

Best Hits

Swiss-Prot: 37% identical to SUGB_MYCTU: Trehalose transport system permease protein SugB (sugB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 95% identity to ara:Arad_9785)

MetaCyc: 37% identical to ABC-type trehalose transporter integral membrane protein (Mycobacterium tuberculosis H37Rv)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>ABIE40_RS21870 carbohydrate ABC transporter permease (Rhizobium sp. OAE497)
MKRKTIDRIGLFFVALVMVSPVILFFLWMISLSLKYEIDNGAYPPILIPERFAWSNYLQV
FQENNFFLYFWNSILVTGGATLLALLIGVPAGYGIARLKAERSAMVIMIARMTPGLSFLI
PLFLLFQWLNLLGTLWPQIIIHLVVTVPIVVWIMIGYFETTPMELEEAASIDGATPWQVF
RLVALPIAKPGIVVAFILSVIFSWNNFVFGIVLASRETRTLPVAVYNMLSFEQVSWGPLA
AAALIVTLPVLVLTMFAQRQIVAGLTAGAVKGG