Protein Info for ABIE40_RS21595 in Rhizobium sp. OAE497

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 95 to 110 (16 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 65 to 333 (269 residues), 112.3 bits, see alignment E=1.2e-36

Best Hits

KEGG orthology group: None (inferred from 52% identity to bpy:Bphyt_4185)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>ABIE40_RS21595 ABC transporter permease (Rhizobium sp. OAE497)
MTINAENIKTMTKSEQAGDMPTVGSRLFGGLDRKRLRAYAPALVLIALCILITIANPNFI
EPRNLVRIANSAAVPLTLAMGLTFIILLGSIDLSVEGSLSVAAMVTVLLATNDANANAYG
WLAVIAAIAASTLMGFTTGIIQTFLRIPSFMATLGVWFIGLGISVYMLGGSAVRLMDPSI
RDLALARFLGLPVAVWVALAAFLIACTVQYYTRLGRHIMAIGGGEDVAELSGINLRRVRI
MAFGLAGFFFGVAGVLAAAQLGRSDAVIADGRLFAAVTAVVVGGTALTGGEGGVINTLVG
VLIVTVLSNGMILLGVSPYVQQTVQGLMIIAAVALSLDRLRLQIVK